Magic™ Membrane Protein Human COL6A3 (Collagen type VI alpha 3 chain) Expressed in vitro E.coli expression system for Antibody Discovery, Partial (2853-3176aa) (CAT#: MPX0855K)

Datasheet

This product is a 50.5 kDa Human COL6A3 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

Host Species
Human

Target Protein
COL6A3

Protein Length
Partial (2853-3176aa)

Protein Class
Cell adhesion

Molecular Weight
50.5 kDa

Sequence
HKQVNVPNNVTSSPTSNPVTTTKPVTTTKPVTTTTKPVTTTTKPVTIINQPSVKPAAAKPAPAKPVAAKPVATKMATVRPPVAVKPATAAKPVAAKPAAVRPPAAAAAKPVATKPEVPRPQAAKPAATKPATTKPMVKMSREVQVFEITENSAKLHWERAEPPGPYFYDLTVTSAHDQSLVLKQNLTVTDRVIGGLLAGQTYHVAVVCYLRSQVRATYHGSFSTKKSQPPPPQPARSASSSTINLMVSTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMG

Product Description

Expression Systems
in vitro E.coli expression system

Tag
6xHis and SUMO tag at the N-terminus

Protein Format
Soluble

Purity
>85% as determined by SDS-PAGE.

Buffer
Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

Target Protein
COL6A3

Full Name
Collagen type VI alpha 3 chain

Introduction
This gene encodes the alpha-3 chain, one of the three alpha chains of type VI collagen, a beaded filament collagen found in most connective tissues. The alpha-3 chain of type VI collagen is much larger than the alpha-1 and -2 chains. This difference in size is largely due to an increase in the number of subdomains, similar to von Willebrand Factor type A domains, that are found in the amino terminal globular domain of all the alpha chains. These domains have been shown to bind extracellular matrix proteins, an interaction that explains the importance of this collagen in organizing matrix components. Mutations in the type VI collagen genes are associated with Bethlem myopathy, a rare autosomal dominant proximal myopathy with early childhood onset. Mutations in this gene are also a cause of Ullrich congenital muscular dystrophy, also referred to as Ullrich scleroatonic muscular dystrophy, an autosomal recessive congenital myopathy that is more severe than Bethlem myopathy. Multiple transcript variants have been identified, but the full-length nature of only some of these variants has been described.

Alternative Names
COL6A3; DYT27; UCMD1; BTHLM1; collagen alpha-3(VI) chain; collagen VI, alpha-3 polypeptide; collagen, type VI, alpha 3; epididymis secretory sperm binding protein; Collagen type VI alpha 3 chain

Gene ID
1293

UniProt ID
P12111

Customer reviews and Q&As Write a review Ask a question

Related Products

Online Inquiry

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: